SCOP 1.73: Domain d1xoxa1: 1xox A:7-117

Lineage for d1xoxa1 (1xox A:7-117)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)

6. Protein Anti-apoptotic protein survivin [57930] (2 species)
   contains a long alpha-helix after the common fold

7. Species Mouse (Mus musculus) [TaxId:10090] [82925] (2 PDB entries)

8. Domain d1xoxa1: 1xox A:7-117 [122208]
   automatically matched to d1m4ma_
   complexed with zn

Details for d1xoxa1

PDB Entry: 1xox

PDB Description: solution structure of human survivin

PDB Compounds: (A:) apoptosis inhibitor survivin

SCOP Domain Sequences for d1xoxa1:

Sequence; same for both SEQRES and ATOM records:

>d1xoxa1 g.52.1.1 (A:7-117) Anti-apoptotic protein survivin {Mouse (Mus musculus) [TaxId: 10090]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

Timeline for d1xoxa1:

• d1xoxa1 is new in SCOP 1.73
  
• d1xoxa1 appears in SCOP 1.75
  
• d1xoxa1 appears in the current release, SCOPe 2.08, called d1xoxa_