PDB entry 1xnc

View 1xnc on RCSB PDB site
Description: thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.59 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.171
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1xnc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xnc_ (-)
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvkcdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftchvnawkshgmnlgsnwayqvmategyqssgss
nvtvw