PDB entry 1xn9

View 1xn9 on RCSB PDB site
Description: Solution Structure of Methanosarcina mazei Protein RPS24E: The Northeast Structural Genomics Consortium Target MaR11
Class: ribosome
Keywords: BETA+ALPHA, GFT NMR, Structural Genomics, Protein Structure Initiative, PSI, NESG, MAR11, Northeast Structural Genomics Consortium
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S24e
    Species: Methanosarcina mazei
    Gene: rps24e
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xn9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xn9A (A:)
mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteyg
mqeskgyaklyedadrmkqveqeyvlkrnavpgsetegeea