Lineage for d1xn9a_ (1xn9 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716544Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
    Pfam PF01282
  6. 716545Protein Ribosomal protein S24e [117787] (3 species)
  7. 716548Species Methanosarcina mazei [TaxId:2209] [117788] (1 PDB entry)
  8. 716549Domain d1xn9a_: 1xn9 A: [115578]
    Structural genomics target

Details for d1xn9a_

PDB Entry: 1xn9 (more details)

PDB Description: solution structure of methanosarcina mazei protein rps24e: the northeast structural genomics consortium target mar11
PDB Compounds: (A:) 30S ribosomal protein S24e

SCOP Domain Sequences for d1xn9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn9a_ d.12.1.3 (A:) Ribosomal protein S24e {Methanosarcina mazei [TaxId: 2209]}
mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteyg
mqeskgyaklyedadrmkqveqeyvlkrnavpgsetegeea

SCOP Domain Coordinates for d1xn9a_:

Click to download the PDB-style file with coordinates for d1xn9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn9a_: