PDB entry 1xgo

View 1xgo on RCSB PDB site
Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Class: aminopeptidase
Keywords: aminopeptidase, hyperthermophile
Deposited on 1997-11-18, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xgoa1, d1xgoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgoA (A:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte