Lineage for d1xgoa2 (1xgo A:1-194,A:272-295)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538190Protein Methionine aminopeptidase [55924] (6 species)
  7. 2538261Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. 2538270Domain d1xgoa2: 1xgo A:1-194,A:272-295 [41159]
    Other proteins in same PDB: d1xgoa1

Details for d1xgoa2

PDB Entry: 1xgo (more details), 3.5 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgoa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOPe Domain Coordinates for d1xgoa2:

Click to download the PDB-style file with coordinates for d1xgoa2.
(The format of our PDB-style files is described here.)

Timeline for d1xgoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgoa1