PDB entry 1xgl

View 1xgl on RCSB PDB site
Description: human insulin disulfide isomer, nmr, 10 structures
Class: hormone
Keywords: hormone, glucose metabolism
Deposited on 1996-10-10, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1xgl.1
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.07: d1xgl.1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xglA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xglB (B:)
  fvnqhlcgshlvealylvcgergffytpkt