PDB entry 1xfb

View 1xfb on RCSB PDB site
Description: Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)
Class: lyase
Keywords: isozyme specificity, structural enzymology, protein-protein interactions, isozyme specific residues, structure/function, LYASE
Deposited on 2004-09-14, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.255
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfba1
  • Chain 'B':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbb_
  • Chain 'C':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbc_
  • Chain 'D':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbd_
  • Chain 'E':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbe_
  • Chain 'F':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbf_
  • Chain 'G':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbg_
  • Chain 'H':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbh_
  • Chain 'I':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbi_
  • Chain 'J':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbj_
  • Chain 'K':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbk_
  • Chain 'L':
    Compound: Aldolase C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfbl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfbA (A:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbA (A:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xfbB (B:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbB (B:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xfbC (C:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbC (C:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xfbD (D:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbD (D:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xfbE (E:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbE (E:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xfbF (F:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbF (F:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xfbG (G:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbG (G:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xfbH (H:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbH (H:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xfbI (I:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbI (I:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xfbJ (J:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbJ (J:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1xfbK (K:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbK (K:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1xfbL (L:)
    mphsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyr
    qvlfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtd
    getttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqq
    ngivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghac
    pikytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltf
    sygralqasalnawrgqrdnagaateefikraevnglaaqgkyegsgedggaaaqslyia
    nhayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfbL (L:)
    hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
    lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
    tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
    ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
    kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
    gralqasalnawrgqrdnagaateefikraevnglaaqgkye