Lineage for d1xfbi_ (1xfb I:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein automated matches [190095] (28 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254965] (1 PDB entry)
  8. Domain d1xfbi_: 1xfb I: [121930]
    Other proteins in same PDB: d1xfba1
    automated match to d1ewda_

Details for d1xfbi_

PDB Entry: 1xfb (more details), 3 Å

PDB Description: Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)
PDB Compounds: (I:) Aldolase C

SCOPe Domain Sequences for d1xfbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfbi_ c.1.10.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
gralqasalnawrgqrdnagaateefikraevnglaaqgkye

SCOPe Domain Coordinates for d1xfbi_ are not available.

Timeline for d1xfbi_:

Domains from other chains:
(mouse over for more information)
d1xfba1, d1xfbb_, d1xfbc_, d1xfbd_, d1xfbe_, d1xfbf_, d1xfbg_, d1xfbh_, d1xfbj_, d1xfbk_, d1xfbl_