PDB entry 1xcm

View 1xcm on RCSB PDB site
Description: Crystal structure of the GppNHp-bound H-Ras G60A mutant
Class: signaling protein
Keywords: GTP-binding protein, Ras, SIGNALING PROTEIN
Deposited on 2004-09-02, released 2005-05-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-166)
      • engineered (59)
      • modified residue (117)
    Domains in SCOPe 2.04: d1xcma1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xcmA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtaa
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhk