PDB entry 1xc0

View 1xc0 on RCSB PDB site
Description: Twenty Lowest Energy Structures of Pa4 by Solution NMR
Class: signaling protein
Keywords: Bend-helix-bend-helix motif, SIGNALING PROTEIN
Deposited on 2004-08-31, released 2004-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pardaxin P-4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81861 (0-32)
  Domains in SCOPe 2.04: d1xc0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xc0A (A:)
  gffalipkiissplfktllsavgsalsssggqe