PDB entry 1x8q

View 1x8q on RCSB PDB site
Description: 0.85 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus in Complex with Water at pH 5.6
Class: ligand binding protein
Keywords: Lipocalin; beta barrel; ferric heme, LIGAND BINDING PROTEIN
Deposited on 2004-08-18, released 2004-10-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: 0.105
AEROSPACI score: 1.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.02: d1x8qa_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x8qA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk