PDB entry 1x8n

View 1x8n on RCSB PDB site
Description: 1.08 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Complexed With Nitric Oxide at pH 7.4
Class: ligand binding protein
Keywords: Lipocalin; beta barrel; heme; nitric oxide, LIGAND BINDING PROTEIN
Deposited on 2004-08-18, released 2004-10-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.136
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
  Domains in SCOPe 2.02: d1x8na_
• Heterogens: HEM, NO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x8nA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk