PDB entry 1x8d

View 1x8d on RCSB PDB site
Description: Crystal structure of E. coli YiiL protein containing L-rhamnose
Class: biosynthetic protein
Keywords: Mutarotase, L-rhamnose, BIOSYNTHETIC PROTEIN
Deposited on 2004-08-18, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yiiL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x8da1
  • Chain 'B':
    Compound: Hypothetical protein yiiL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x8db_
  • Chain 'C':
    Compound: Hypothetical protein yiiL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x8dc_
  • Chain 'D':
    Compound: Hypothetical protein yiiL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x8dd_
  • Heterogens: RNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x8dA (A:)
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x8dB (B:)
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x8dC (C:)
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x8dD (D:)
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp