SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1x8dc_ (1x8d C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173183Family d.58.4.21: YiiL-like [160298] (1 protein)
    Pfam PF05336; DUF718
  6. 2173184Protein L-rhamnose mutarotase YiiL [160299] (1 species)
  7. 2173185Species Escherichia coli [TaxId:562] [160300] (1 PDB entry)
    Uniprot P32156 1-104
  8. 2173188Domain d1x8dc_: 1x8d C: [145857]
    automated match to d1x8da1
    complexed with rns

Details for d1x8dc_

PDB Entry: 1x8d (more details), 1.8 Å

PDB Description: Crystal structure of E. coli YiiL protein containing L-rhamnose
PDB Compounds: (C:) Hypothetical protein yiiL

SCOPe Domain Sequences for d1x8dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8dc_ d.58.4.21 (C:) L-rhamnose mutarotase YiiL {Escherichia coli [TaxId: 562]}
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

SCOPe Domain Coordinates for d1x8dc_:

Click to download the PDB-style file with coordinates for d1x8dc_.
(The format of our PDB-style files is described here.)

Timeline for d1x8dc_: