PDB entry 1x77

View 1x77 on RCSB PDB site
Description: Crystal structure of a NAD(P)H-dependent FMN reductase complexed with FMN
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein Structure Initiative (PSI), FMN reductase, FMN bound, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2004-08-13, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x77a_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x77b_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x77A (A:)
    mslsddikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfp
    paverfreqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagr
    fgtaraqyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql
    wvreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x77A (A:)
    ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
    reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
    qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x77B (B:)
    mslsddikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfp
    paverfreqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagr
    fgtaraqyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql
    wvreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x77B (B:)
    ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
    reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
    qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql