SCOPe 2.08: Domain d1x77b_: 1x77 B:

Lineage for d1x77b_ (1x77 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
   Pfam PF03358

6. Protein Hypothetical protein PA1204 [110475] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110476] (2 PDB entries)
   Uniprot Q9I4D4 5-167

8. Domain d1x77b_: 1x77 B: [109497]
   Structural genomics target
   complexed with fmn

Details for d1x77b_

PDB Entry: 1x77, 2.7 Å

PDB Description: crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1x77b_:

Sequence; same for both SEQRES and ATOM records:

>d1x77b_ c.23.5.4 (B:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]}
ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql

Timeline for d1x77b_:

• d1x77b_ first appeared in SCOP 1.69
  
• d1x77b_ appears in SCOPe 2.07