PDB entry 1x5x

View 1x5x on RCSB PDB site
Description: Solution structure of the fibronectin type-III domain of human fibronectin type III domain containing protein 3
Class: structural genomics, unknown function
Keywords: Fibronectin type III domain containing protein, structural genomics, KIAA0970, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin type-III domain containing protein 3a
    Species: Homo sapiens [TaxId:9606]
    Gene: FNDC3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H6 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.07: d1x5xa1, d1x5xa2, d1x5xa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5xA (A:)
    gssgssgpsmpaspvltkagitwlslqwskpsgtpsdegisyilemeeetsgygfkpkyd
    gedlaytvknlrrstkykfkviaynsegksnpsevvefttcpdsgpssg