PDB entry 1x58

View 1x58 on RCSB PDB site
Description: Solution structures of the myb-like DNA binding domain of 4930532D21Rik protein
Class: structural genomics, unknown function
Keywords: Mus musculus adult male testis cDNA, RIKEN full-length enriched library, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein 4930532D21Rik
    Species: Mus musculus [TaxId:10090]
    Gene: 4930532D21Rik
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C0V1 (7-55)
      • cloning artifact (0-6)
      • cloning artifact (56-61)
    Domains in SCOPe 2.08: d1x58a1, d1x58a2, d1x58a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x58A (A:)
    gssgssgrkdftkeevnylfhgvktmgnhwnsilwsfpfqkgrravdlahkyhrlisgps
    sg