Lineage for d1x58a1 (1x58 A:8-56)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981149Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 1981238Protein Hypothetical protein 4930532d21rik [140157] (1 species)
  7. 1981239Species Mouse (Mus musculus) [TaxId:10090] [140158] (1 PDB entry)
    Uniprot Q8C0V1 712-760
  8. 1981240Domain d1x58a1: 1x58 A:8-56 [121705]
    Other proteins in same PDB: d1x58a2, d1x58a3

Details for d1x58a1

PDB Entry: 1x58 (more details)

PDB Description: Solution structures of the myb-like DNA binding domain of 4930532D21Rik protein
PDB Compounds: (A:) Hypothetical protein 4930532D21Rik

SCOPe Domain Sequences for d1x58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]}
rkdftkeevnylfhgvktmgnhwnsilwsfpfqkgrravdlahkyhrli

SCOPe Domain Coordinates for d1x58a1:

Click to download the PDB-style file with coordinates for d1x58a1.
(The format of our PDB-style files is described here.)

Timeline for d1x58a1: