Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Hypothetical protein 4930532d21rik [140157] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [140158] (1 PDB entry) Uniprot Q8C0V1 712-760 |
Domain d1x58a1: 1x58 A:8-56 [121705] Other proteins in same PDB: d1x58a2, d1x58a3 |
PDB Entry: 1x58 (more details)
SCOPe Domain Sequences for d1x58a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} rkdftkeevnylfhgvktmgnhwnsilwsfpfqkgrravdlahkyhrli
Timeline for d1x58a1: