PDB entry 1x40

View 1x40 on RCSB PDB site
Description: Solution structure of the SAM domain of human ARAP2
Class: structural genomics, unknown function
Keywords: ASAP-related protein2, GTPase activity, Signal transduction, SAM domain, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-12, released 2005-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arap2
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0580
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WZ64 (7-84)
    • cloning artifact (0-6)
    • cloning artifact (85-90)
  Domains in SCOPe 2.07: d1x40a1, d1x40a2, d1x40a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x40A (A:)
  gssgssgmssvsevnvdikdflmsinleqyllhfhesgfttvkdcaaindsllqkigisp
  tghrrrilkqlqiilskmqdipiyasgpssg