PDB entry 1x32

View 1x32 on RCSB PDB site
Description: Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
Class: signaling protein
Keywords: Signal recognition particle, cpSRP43, Chromo domain 1, LHCP, thylakoid, SIGNALING PROTEIN
Deposited on 2005-04-28, released 2005-09-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chloroplast signal recognition particle component
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O22265 (2-46)
    • cloning artifact (0-1)
  Domains in SCOPe 2.04: d1x32a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x32A (A:)
  gsgevnkiigsrtagegameyliewkdghspswvpssyiaadvvsey