PDB entry 1x2t
View 1x2t on RCSB PDB site
Description: Crystal Structure of Habu IX-bp at pH 6.5
Class: protein binding
Keywords: heterodimer, domain swapping, c-type lectin-like protein, protein binding
Deposited on
2005-04-26, released
2005-10-04
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.191
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Coagulation factor IX/X-binding protein A chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1x2ta_ - Chain 'B':
Compound: Coagulation factor IX/factor X-binding protein B chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1x2tb_ - Chain 'C':
Compound: Coagulation factor IX/X-binding protein A chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1x2tc_ - Chain 'D':
Compound: Coagulation factor IX/factor X-binding protein B chain
Species: Trimeresurus flavoviridis [TaxId:88087]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1x2td_ - Heterogens: CA, 1PE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1x2tA (A:)
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1x2tB (B:)
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1x2tC (C:)
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1x2tD (D:)
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa