PDB entry 1x2h

View 1x2h on RCSB PDB site
Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli complexed with lipoic acid
Class: ligase
Keywords: lipoate-protein ligase, lipoic acid, protein acylation, post-translational modification
Deposited on 2005-04-23, released 2005-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.191
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32099 (0-336)
      • modified residue (26)
      • modified residue (59)
      • modified residue (88)
      • modified residue (305)
      • modified residue (331)
    Domains in SCOPe 2.06: d1x2ha1, d1x2ha2
  • Chain 'B':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32099 (0-336)
      • modified residue (26)
      • modified residue (59)
      • modified residue (88)
      • modified residue (305)
      • modified residue (331)
    Domains in SCOPe 2.06: d1x2hb1, d1x2hb2
  • Chain 'C':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32099 (0-336)
      • modified residue (26)
      • modified residue (59)
      • modified residue (88)
      • modified residue (305)
      • modified residue (331)
    Domains in SCOPe 2.06: d1x2hc1, d1x2hc2
  • Heterogens: LPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2hA (A:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2hA (A:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakrvtnl
    tellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfgq
    apafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradml
    qqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x2hB (B:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2hB (B:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakrvtnl
    tellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfgq
    apafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradml
    qqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2hC (C:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr