PDB entry 1x0g

View 1x0g on RCSB PDB site
Description: Crystal Structure of IscA with the [2Fe-2S] cluster
Class: metal binding protein
Keywords: [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe-S cluster, iron, iron-sulfur cluster protein, Isc, IscA, scaffold, sulfur, tetrameric, three conserved Cys, METAL BINDING PROTEIN
Deposited on 2005-03-22, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IscA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll0464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0ga_
  • Chain 'B':
    Compound: IscA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll0464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0gb_
  • Chain 'C':
    Compound: IscA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll0464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0gc_
  • Chain 'D':
    Compound: IscA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: tll0464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0gd_
  • Heterogens: NA, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0gA (A:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0gA (A:)
    mveltpaaiqelerlqilriqvqpsecgdwrydlalvaepkptdlltqsqgwtiaiaaea
    aellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0gB (B:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0gB (B:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x0gC (C:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0gC (C:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x0gD (D:)
    mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
    gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0gD (D:)
    mveltpaaiqelerlqthaailriqvqpsecgdwrydlalvaepkptdlltqsqgwtiai
    aaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs