Lineage for d1x0ga_ (1x0g A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411897Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2411898Superfamily b.124.1: HesB-like domain [89360] (2 families) (S)
  5. 2411914Family b.124.1.0: automated matches [227171] (1 protein)
    not a true family
  6. 2411915Protein automated matches [226886] (3 species)
    not a true protein
  7. 2411921Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry)
  8. 2411922Domain d1x0ga_: 1x0g A: [203049]
    automated match to d1nwba_
    complexed with fes, na

Details for d1x0ga_

PDB Entry: 1x0g (more details), 2.5 Å

PDB Description: Crystal Structure of IscA with the [2Fe-2S] cluster
PDB Compounds: (A:) IscA

SCOPe Domain Sequences for d1x0ga_:

Sequence, based on SEQRES records: (download)

>d1x0ga_ b.124.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs

Sequence, based on observed residues (ATOM records): (download)

>d1x0ga_ b.124.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mveltpaaiqelerlqilriqvqpsecgdwrydlalvaepkptdlltqsqgwtiaiaaea
aellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsrs

SCOPe Domain Coordinates for d1x0ga_:

Click to download the PDB-style file with coordinates for d1x0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1x0ga_: