PDB entry 1wz6

View 1wz6 on RCSB PDB site
Description: Solution Structure of the HMG_box Domain of Murine Bobby Sox Homolog
Class: transcription
Keywords: bobby sox homolog, transcription factor, HMG_box domain, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, National Project on Protein Structural and Functional Analyses, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-02-25, released 2005-08-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HMG-BOX transcription factor BBX
  Species: Mus musculus [TaxId:10090]
  Gene: Bbx
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CDV1 (7-75)
    • cloning artifact (0-6)
    • cloning artifact (76-81)
  Domains in SCOPe 2.05: d1wz6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wz6A (A:)
  gssgssgarrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdm
  akeykdafmkanpgyrsgpssg