Lineage for d1wz6a_ (1wz6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725656Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 1725657Protein automated matches [191268] (4 species)
    not a true protein
  7. 1725666Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries)
  8. 1725668Domain d1wz6a_: 1wz6 A: [240937]
    automated match to d2lefa_

Details for d1wz6a_

PDB Entry: 1wz6 (more details)

PDB Description: solution structure of the hmg_box domain of murine bobby sox homolog
PDB Compounds: (A:) HMG-BOX transcription factor BBX

SCOPe Domain Sequences for d1wz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz6a_ a.21.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgarrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdm
akeykdafmkanpgyrsgpssg

SCOPe Domain Coordinates for d1wz6a_:

Click to download the PDB-style file with coordinates for d1wz6a_.
(The format of our PDB-style files is described here.)

Timeline for d1wz6a_: