PDB entry 1wz5

View 1wz5 on RCSB PDB site
Description: Solution structure of Pi1-3p
Class: toxin
Keywords: ionic channel inhibitor, toxin
Deposited on 2005-02-24, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel blocking toxin 1
    Species: Pandinus imperator [TaxId:55084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10726 (0-34)
      • modified residue (19)
      • modified residue (34)
    Domains in SCOPe 2.06: d1wz5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wz5A (A:)
    lvkcrgtsdcgrpcqqqtgapnskcinrmckcyga