PDB entry 1wyq

View 1wyq on RCSB PDB site
Description: Solution structure of the second CH domain of human spectrin beta chain, brain 2
Class: Structural Protein
Keywords: NPPSFA, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Protein
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Spectrin beta chain, brain 2
  Species: Homo sapiens [TaxId:9606]
  Gene: SPTBN2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15020 (7-120)
    • cloning artifact (0-6)
    • cloning artifact (121-126)
  Domains in SCOPe 2.07: d1wyqa1, d1wyqa2, d1wyqa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wyqA (A:)
  gssgssgakdalllwcqmktagypnvnvhnfttswrdglafnaivhkhrpdlldfeslkk
  cnahynlqnafnlaekelgltklldpedvnvdqpdeksiityvatyyhyfskmkalaveg
  ksgpssg