PDB entry 1wym

View 1wym on RCSB PDB site
Description: Solution structure of the CH domain of human transgelin-2
Class: structural protein
Keywords: CH domain, F-actin binding, all helix, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, STRUCTURAL PROTEIN
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transgelin-2
  Species: Homo sapiens [TaxId:9606]
  Gene: TAGLN2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37802 (7-148)
    • cloning artifact (0-6)
    • cloning artifact (149-154)
  Domains in SCOPe 2.07: d1wyma1, d1wyma2, d1wyma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wymA (A:)
  gssgssgqkiekqydadleqiliqwittqcrkdvgrpqpgrenfqnwlkdgtvlcelina
  lypegqapvkkiqastmafkqmeqisqflqaaeryginttdifqtvdlwegknmacvqrt
  lmnlgglavarddglfsgdpnwfpkkskesgpssg