PDB entry 1wtq

View 1wtq on RCSB PDB site
Description: Hyperthermophile chromosomal protein SAC7D single mutant M29F in complex with DNA GTAATTAC
Class: DNA binding protein/DNA
Keywords: COMPLEX CHROMATIN PROTEIN/DNA, MINOR-GROOVE DNA BINDING, ARCHEA, KINKED-DNA, INTERCALATION, Sac7d mutant, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2004-11-29, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding proteins 7a/7b/7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123
      • engineered (28)
    Domains in SCOPe 2.07: d1wtqa_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wtqA (A:)
    mvkvkfkykgeekevdtskikkvwrvgkfvsftyddngktgrgavsekdapkelldmlar
    aerekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtqA (A:)
    vkvkfkykgeekevdtskikkvwrvgkfvsftyddngktgrgavsekdapkelldmlara
    erek
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.