Lineage for d1wtqa_ (1wtq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785055Protein automated matches [190114] (2 species)
    not a true protein
  7. 2785056Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2785062Domain d1wtqa_: 1wtq A: [161984]
    automated match to d1azpa_
    protein/DNA complex; mutant

Details for d1wtqa_

PDB Entry: 1wtq (more details), 1.7 Å

PDB Description: hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gtaattac
PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d

SCOPe Domain Sequences for d1wtqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtqa_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
vkvkfkykgeekevdtskikkvwrvgkfvsftyddngktgrgavsekdapkelldmlara
erek

SCOPe Domain Coordinates for d1wtqa_:

Click to download the PDB-style file with coordinates for d1wtqa_.
(The format of our PDB-style files is described here.)

Timeline for d1wtqa_: