PDB entry 1wt8

View 1wt8 on RCSB PDB site
Description: Solution Structure of BmP08 from the Venom of Scorpion Buthus martensii Karsch, 20 structures
Class: toxin
Keywords: ALPHA/BETA scaffold, TOXIN
Deposited on 2004-11-17, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurotoxin BmK X
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z0H4 (0-30)
  Domains in SCOPe 2.08: d1wt8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wt8A (A:)
  tpypvncktdrdcvmcglgisckngycqgct