Lineage for d1wt8a_ (1wt8 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030594Protein Bmkx [103546] (1 species)
  7. 3030595Species Chinese scorpion (Buthus martensi karsch) [TaxId:34649] [103547] (2 PDB entries)
  8. 3030597Domain d1wt8a_: 1wt8 A: [121253]
    automated match to d1rjia_

Details for d1wt8a_

PDB Entry: 1wt8 (more details)

PDB Description: solution structure of bmp08 from the venom of scorpion buthus martensii karsch, 20 structures
PDB Compounds: (A:) Neurotoxin BmK X

SCOPe Domain Sequences for d1wt8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wt8a_ g.3.7.2 (A:) Bmkx {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]}
tpypvncktdrdcvmcglgisckngycqgct

SCOPe Domain Coordinates for d1wt8a_:

Click to download the PDB-style file with coordinates for d1wt8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wt8a_: