PDB entry 1ws3

View 1ws3 on RCSB PDB site
Description: Urate oxidase from aspergillus flavus complexed with uracil
Class: oxidoreductase
Keywords: oxidoreductase, uric acid degradation, dimeric barrel, tunnel-shaped protein
Deposited on 2004-10-29, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.146
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ws3a1, d1ws3a2
  • Chain 'B':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ws3b1, d1ws3b2
  • Chain 'C':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ws3c1, d1ws3c2
  • Chain 'D':
    Compound: Uricase
    Species: Aspergillus flavus [TaxId:5059]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00511 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ws3d1, d1ws3d2
  • Heterogens: URA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ws3A (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws3A (A:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ws3B (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws3B (B:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ws3C (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws3C (C:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ws3D (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslksk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws3D (D:)
    savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
    kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
    irdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilst
    dvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqila
    rqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrss