Lineage for d1ws3b1 (1ws3 B:1-136)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)
  8. Domain d1ws3b1: 1ws3 B:1-136 [121216]
    automatically matched to d1r4sa1
    complexed with ura

Details for d1ws3b1

PDB Entry: 1ws3 (more details), 3.2 Å

PDB Description: urate oxidase from aspergillus flavus complexed with uracil
PDB Compounds: (B:) Uricase

SCOPe Domain Sequences for d1ws3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws3b1 d.96.1.4 (B:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

SCOPe Domain Coordinates for d1ws3b1 are not available.

Timeline for d1ws3b1:

Domains from same chain:
(mouse over for more information)
d1ws3b2
Domains from other chains:
(mouse over for more information)
d1ws3a1, d1ws3a2, d1ws3c1, d1ws3c2, d1ws3d1, d1ws3d2