PDB entry 1wpd

View 1wpd on RCSB PDB site
Description: evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins
Deposited on 2004-09-01, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wpda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpdA (A:)
    vsctgskdcyapcrkqtgcpygkcmnrkckcnrc