Lineage for d1wpda_ (1wpd A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621806Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 621876Family g.3.7.2: Short-chain scorpion toxins [57116] (34 proteins)
  6. 621945Protein Maurotoxin [57129] (1 species)
  7. 621946Species Scorpion (Scorpio maurus) [TaxId:53956] [57130] (3 PDB entries)
  8. 621949Domain d1wpda_: 1wpd A: [114801]
    chimera with hstx1

Details for d1wpda_

PDB Entry: 1wpd (more details)

PDB Description: evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins

SCOP Domain Sequences for d1wpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpda_ g.3.7.2 (A:) Maurotoxin {Scorpion (Scorpio maurus)}
vsctgskdcyapcrkqtgcpygkcmnrkckcnrc

SCOP Domain Coordinates for d1wpda_:

Click to download the PDB-style file with coordinates for d1wpda_.
(The format of our PDB-style files is described here.)

Timeline for d1wpda_: