PDB entry 1wou

View 1wou on RCSB PDB site
Description: Crystal Structure of human Trp14
Class: electron transport
Keywords: electron transport
Deposited on 2004-08-25, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin -related protein, 14 kDa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wouA (A:)
    maryeevsvsgfeefhraveqhngktifayftgskdaggkswcpdcvqaepvvreglkhi
    segcvfiycqvgekpywkdpnndfrknlkvtavptllkygtpqklveseclqanlvemlf
    sed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wouA (A:)
    yeevsvsgfeefhraveqhngktifayftgskdaggkswcpdcvqaepvvreglkhiseg
    cvfiycqvgekpywkdpnndfrknlkvtavptllkygtpqklveseclqanlvemlfse