![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.16: Txnl5-like [110612] (1 protein) Pfam PF06110 |
![]() | Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110615] (1 PDB entry) Uniprot Q9BRA2 |
![]() | Domain d1woua_: 1wou A: [109471] |
PDB Entry: 1wou (more details), 1.8 Å
SCOPe Domain Sequences for d1woua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} yeevsvsgfeefhraveqhngktifayftgskdaggkswcpdcvqaepvvreglkhiseg cvfiycqvgekpywkdpnndfrknlkvtavptllkygtpqklveseclqanlvemlfse
Timeline for d1woua_: