Lineage for d1woua_ (1wou A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878861Family c.47.1.16: Txnl5-like [110612] (1 protein)
    Pfam PF06110
  6. 2878862Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species)
  7. 2878863Species Human (Homo sapiens) [TaxId:9606] [110615] (1 PDB entry)
    Uniprot Q9BRA2
  8. 2878864Domain d1woua_: 1wou A: [109471]

Details for d1woua_

PDB Entry: 1wou (more details), 1.8 Å

PDB Description: Crystal Structure of human Trp14
PDB Compounds: (A:) thioredoxin -related protein, 14 kDa

SCOPe Domain Sequences for d1woua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]}
yeevsvsgfeefhraveqhngktifayftgskdaggkswcpdcvqaepvvreglkhiseg
cvfiycqvgekpywkdpnndfrknlkvtavptllkygtpqklveseclqanlvemlfse

SCOPe Domain Coordinates for d1woua_:

Click to download the PDB-style file with coordinates for d1woua_.
(The format of our PDB-style files is described here.)

Timeline for d1woua_: