PDB entry 1wom

View 1wom on RCSB PDB site
Description: Crystal structure of RsbQ
Class: signaling protein
Keywords: alpha/beta hydrolase, SIGNALING PROTEIN
Deposited on 2004-08-21, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sigma factor sigB regulation protein rsbQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rsbq
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07015 (6-270)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d1woma1, d1woma2
  • Chain 'B':
    Compound: Sigma factor sigB regulation protein rsbQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rsbq
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07015 (6-270)
      • cloning artifact (1-5)
    Domains in SCOPe 2.07: d1womb1, d1womb2
  • Heterogens: MLA, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1womA (A:)
    aghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghs
    dlraydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvm
    vgpspcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeeles
    rfcstdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpyss
    lkqmearghcphmshpdetiqligdylkahv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1womB (B:)
    aghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghs
    dlraydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvm
    vgpspcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeeles
    rfcstdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpyss
    lkqmearghcphmshpdetiqligdylkahv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1womB (B:)
    ghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsd
    lraydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmv
    gpspcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesr
    fcstdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpyssl
    kqmearghcphmshpdetiqligdylkahv