Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225226] (4 PDB entries) |
Domain d1woma1: 1wom A:5-269 [230386] Other proteins in same PDB: d1woma2, d1womb2 automated match to d3t52b_ complexed with mla, pgo |
PDB Entry: 1wom (more details), 2.5 Å
SCOPe Domain Sequences for d1woma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woma1 c.69.1.0 (A:5-269) automated matches {Bacillus subtilis [TaxId: 1423]} ilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsdlrayd lnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgpspc ylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfcstd pviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkqmea rghcphmshpdetiqligdylkahv
Timeline for d1woma1: