SCOPe 2.08: Domain d1woma1: 1wom A:5-269

Lineage for d1woma1 (1wom A:5-269)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225226] (4 PDB entries)

8. Domain d1woma1: 1wom A:5-269 [230386]
   Other proteins in same PDB: d1woma2, d1womb2
   automated match to d3t52b_
   complexed with mla, pgo

Details for d1woma1

PDB Entry: 1wom, 2.5 Å

PDB Description: crystal structure of rsbq

PDB Compounds: (A:) Sigma factor sigB regulation protein rsbQ

SCOPe Domain Sequences for d1woma1:

Sequence; same for both SEQRES and ATOM records:

>d1woma1 c.69.1.0 (A:5-269) automated matches {Bacillus subtilis [TaxId: 1423]}
ilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsdlrayd
lnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgpspc
ylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfcstd
pviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkqmea
rghcphmshpdetiqligdylkahv

Timeline for d1woma1:

• d1woma1 first appeared in SCOPe 2.03, called d1woma_
  
• d1woma1 appears in SCOPe 2.07