PDB entry 1wmt

View 1wmt on RCSB PDB site
Description: Scorpion toxin (IsTX) from Opisthacanthus madagascariensis
Class: toxin
Keywords: neurotoxin, potassium channel blocker, NMR solution structure, alpha-k toxin family, scorpion toxin
Deposited on 2004-07-20, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IsTX
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1WMT (0-40)
    Domains in SCOPe 2.07: d1wmta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmtA (A:)
    vhtnipcrgtsdcyepcekkyncarakcmnrhcncynncpw