PDB entry 1wm4

View 1wm4 on RCSB PDB site
Description: Solution structure of mouse coactosin, an actin filament binding protein
Class: protein binding
Keywords: ADF-H domain, PROTEIN BINDING
Deposited on 2004-07-03, released 2004-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wm4A (A:)
    matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfa
    fvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkel
    eedfirselkkagganydaqse