PDB entry 1wm3

View 1wm3 on RCSB PDB site
Description: Crystal structure of human SUMO-2 protein
Deposited on 2004-07-02, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.119
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1wm3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wm3A (A:)
  hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
  emededtidvfq