Lineage for d1wm3a_ (1wm3 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598490Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
    Pfam 00240
  6. 598550Protein SUMO-2 [117816] (1 species)
  7. 598551Species Human (Homo sapiens) [TaxId:9606] [117817] (2 PDB entries)
  8. 598552Domain d1wm3a_: 1wm3 A: [114736]

Details for d1wm3a_

PDB Entry: 1wm3 (more details), 1.2 Å

PDB Description: Crystal structure of human SUMO-2 protein

SCOP Domain Sequences for d1wm3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens)}
hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
emededtidvfq

SCOP Domain Coordinates for d1wm3a_:

Click to download the PDB-style file with coordinates for d1wm3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm3a_: