PDB entry 1wkj

View 1wkj on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
Class: transferase
Keywords: nucleoside diphosphate kinase, Thermus thermophilus HB8, kinase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-05-31, released 2005-08-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Thermus thermophilus [TaxId:274]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wkja1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Thermus thermophilus [TaxId:274]
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wkjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wkjA (A:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wkjB (B:)
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell