PDB entry 1wjj

View 1wjj on RCSB PDB site
Description: Solution structure of hypothetical protein F20O9.120 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: hypothetical protein, DNA-binding protein-related, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein F20O9.120
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RIKEN cDNA RAFL07-09-H05
  Database cross-references and differences (RAF-indexed):
  • Uniprot O49453 (7-138)
    • cloning artifact (0-6)
    • cloning artifact (139-144)
  Domains in SCOPe 2.06: d1wjja1, d1wjja2, d1wjja3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjjA (A:)
  gssgssgstvkrkpvfvkveqlkpgttghtltvkvieanivvpvtrktrpasslsrpsqp
  srivecligdetgcilftarndqvdlmkpgatvilrnsridmfkgtmrlgvdkwgrieat
  gaasftvkednnlslveyesgpssg