PDB entry 1wiy

View 1wiy on RCSB PDB site
Description: Crystal Structure Analysis of a 6-coordinated Cytochorome P450 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: P450, Cytochrome, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wiya_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wiyb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wiyA (A:)
    mkrlslreawpylkdlqqdplavllewgrahprlflplprfplalifdpegvegallaeg
    ttkatfqyralsrltgrglltdwgkswkearkalkdpflpksvrgyreameeeawaffge
    wrgeerdldhemlalslrllgralfgkplspslaehalkaldrimaqtrsplalldlaae
    arfrkdrgalyreaealivhpplshlpreralseavtllvaghetvasaltwsflllshr
    pdwqkrvaeseeaalaafqealrlyppawiltrrlerplllgedrlpqgttlvlspyvtq
    rlyfpegeafqperflaergtpsgryfpfglgqrlclgrdfallegpivlraffrrfrld
    plpfprvlaqvtlrpegglparpregvra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wiyA (A:)
    mkrlsldplavllewgrahprlflpplalifdpegvegallaegttkatfqyralsrltg
    rglltdwgkswkearkalkdpflpksvrgyreameeeawaffgewrgeerdldhemlals
    lrllgralfgkplspslaehalkaldrimlaaearfrkdrgalyreaealivhpplshlp
    reralseavtllvaghetvasaltwsflllshrpdwqkrvaeseeaalaafqealrlypp
    awiltrrlerplllgedrlpqgttlvlspyvtqrlyfpegeafqperflaergtpsgryf
    pfglgqrlclgrdfallegpivlraffrrfrldplpfprvlaqvtlrpegglparpre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wiyB (B:)
    mkrlslreawpylkdlqqdplavllewgrahprlflplprfplalifdpegvegallaeg
    ttkatfqyralsrltgrglltdwgkswkearkalkdpflpksvrgyreameeeawaffge
    wrgeerdldhemlalslrllgralfgkplspslaehalkaldrimaqtrsplalldlaae
    arfrkdrgalyreaealivhpplshlpreralseavtllvaghetvasaltwsflllshr
    pdwqkrvaeseeaalaafqealrlyppawiltrrlerplllgedrlpqgttlvlspyvtq
    rlyfpegeafqperflaergtpsgryfpfglgqrlclgrdfallegpivlraffrrfrld
    plpfprvlaqvtlrpegglparpregvra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wiyB (B:)
    mkrlsdplavllewgrahprlflplpfplalifdpegvegallaegttkatfqyralsrl
    tgrglltdwgkswkearkalkdpflpksvrgyreameeeawaffgewrgeerdldhemla
    lslrllgralfgkplspslaehalkaldrimaqtdlaaearfrkdrgalyreaealivhp
    plshlpreralseavtllvaghetvasaltwsflllshrpdwqkrvaeseeaalaafqea
    lrlyppawiltrrlerplllgedrlpqgttlvlspyvtqrlyfpegeafqperflrgtps
    gryfpfglgqrlclgrdfallegpivlraffrrfrldplpfprvlaqvtlrpegglparp
    re